PDB entry 3q6w

View 3q6w on RCSB PDB site
Description: Structure of dually-phosphorylated MET receptor kinase in complex with an MK-2461 analog with specificity for the activated receptor
Class: transferase/transferase inhibitor
Keywords: Tyrosine Kinase, two phosphotyrosine resiudes, transferase-transferase inhibitor complex
Deposited on 2011-01-03, released 2011-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-300)
      • expression tag (301-304)
    Domains in SCOPe 2.06: d3q6wa1, d3q6wa2
  • Heterogens: Q6W, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q6wA (A:)
    qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
    dmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
    ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6wA (A:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfdit
    vyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehhhhh