PDB entry 3q6u

View 3q6u on RCSB PDB site
Description: Structure of the apo MET receptor kinase in the dually-phosphorylated, activated state
Class: transferase
Keywords: tyrosine kinase, TRANSFERASE
Deposited on 2011-01-03, released 2011-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (1-301)
      • expression tag (0)
      • expression tag (302-307)
    Domains in SCOPe 2.06: d3q6ua1, d3q6ua2, d3q6ua3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q6uA (A:)
    xqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6uA (A:)
    xqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglp
    vkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpe
    ycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehhhhhhh