PDB entry 3q6s

View 3q6s on RCSB PDB site
Description: The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from Shugoshin 1
Class: cell cycle
Keywords: INCENP, heterochromatin, centromere, CELL CYCLE
Deposited on 2011-01-03, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q6sa_
  • Chain 'B':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q6sb_
  • Chain 'C':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q6sc_
  • Chain 'D':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q6sd_
  • Chain 'E':
    Compound: Shugoshin-like 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Shugoshin-like 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q6sA (A:)
    ekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeer
    ltwhsypsedddkkddkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6sA (A:)
    kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
    twhsyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q6sB (B:)
    ekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeer
    ltwhsypsedddkkddkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6sB (B:)
    kprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerl
    twhsyps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q6sC (C:)
    ekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeer
    ltwhsypsedddkkddkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6sC (C:)
    prgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerlt
    whsy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q6sD (D:)
    ekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeer
    ltwhsypsedddkkddkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6sD (D:)
    prgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisfyeerlt
    whsyp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.