PDB entry 3q6g

View 3q6g on RCSB PDB site
Description: Crystal structure of Fab of rhesus mAb 2.5B specific for quaternary neutralizing epitope of HIV-1 gp120
Class: immune system
Keywords: Ig, neutralization of HIV-1 viruses, Quaternary epitope of HIV-1 gp120, IMMUNE SYSTEM
Deposited on 2010-12-31, released 2011-05-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of Fab of rhesus mAb 2.5B
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6G (0-233)
  • Chain 'I':
    Compound: Heavy chain of Fab of rhesus mAb 2.5B
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6G (0-233)
  • Chain 'L':
    Compound: Light chain of Fab of rhesus mAb 2.5B
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6G (0-208)
    Domains in SCOPe 2.03: d3q6gl1, d3q6gl2
  • Chain 'M':
    Compound: Light chain of Fab of rhesus mAb 2.5B
    Species: Macaca mulatta [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6G (0-208)
    Domains in SCOPe 2.03: d3q6gm1, d3q6gm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q6gL (L:)
    ydltqarsvsvspgqtarvtcggdnigsksvqwyqqkppqapvlvmsadderssgiperf
    sgsnsgntatltisgveagdeadyycqvwdssshhmlfgggtrltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavevawkadgsavnagvettkpskqsnnkyaassyls
    ltsdqwkshksyscqvthegstvektvap
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q6gM (M:)
    ydltqarsvsvspgqtarvtcggdnigsksvqwyqqkppqapvlvmsadderssgiperf
    sgsnsgntatltisgveagdeadyycqvwdssshhmlfgggtrltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavevawkadgsavnagvettkpskqsnnkyaassyls
    ltsdqwkshksyscqvthegstvektvap