PDB entry 3q62

View 3q62 on RCSB PDB site
Description: Crystal Structure of 3-hydroxydecanoyl-(acyl carrier protein) dehydratase from Yersinia pestis
Class: lyase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta fold, hotdog fold, LYASE
Deposited on 2010-12-30, released 2011-01-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.151
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pseudotuberculosis [TaxId:214092]
    Gene: fabA, YPTB1450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q66CF3 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3q62a_
  • Chain 'B':
    Compound: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
    Species: Yersinia pseudotuberculosis [TaxId:214092]
    Gene: fabA, YPTB1450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q66CF3 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.01: d3q62b_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q62A (A:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q62A (A:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimlimgvadgevlvdgkviytatdlkvglfkdt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q62B (B:)
    snamvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyvea
    eldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgq
    vlpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q62B (B:)
    namvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveae
    ldinpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqv
    lpdakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdt