PDB entry 3q5o

View 3q5o on RCSB PDB site
Description: Crystal structure of human titin domain M10
Class: transferase
Keywords: I-set Ig, titin, obscurin, obscurin-like 1, sarcomere, M-band, TRANSFERASE
Deposited on 2010-12-29, released 2012-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (2-99)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d3q5oa1, d3q5oa2
  • Chain 'B':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (2-99)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d3q5ob1, d3q5ob2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3q5oA (A:)
gpgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientd
dlttliimdvqkqdgglytlslgnefgsdsatvnihirsi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3q5oB (B:)
gpgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientd
dlttliimdvqkqdgglytlslgnefgsdsatvnihirsi