PDB entry 3q4y

View 3q4y on RCSB PDB site
Description: Crystal structure of group I phospholipase A2 at 2.3 A resolution in 40% ethanol revealed the critical elements of hydrophobicity of the substrate-binding site
Class: hydrolase
Keywords: Hydrolase, Ethanol
Deposited on 2010-12-26, released 2011-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 isoform 3
  Species: Naja sagittifera [TaxId:195058]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60045 (0-118)
    • conflict (18)
    • conflict (45)
  Domains in SCOPe 2.08: d3q4ya_
• Heterogens: CA, EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3q4yA (A:)
  nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
  rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn