PDB entry 3q46

View 3q46 on RCSB PDB site
Description: Magnesium activated Inorganic pyrophosphatase from Thermococcus thioreducens bound to hydrolyzed product at 0.99 Angstrom resolution
Class: hydrolase
Keywords: Inorganic Pyrophosphatase, HYDROLASE
Deposited on 2010-12-23, released 2012-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.111
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tt-IPPase
  Species: Thermococcus thioreducens [TaxId:277988]
  Gene: Tt-IPPase
  Database cross-references and differences (RAF-indexed):
  • PDB 3Q46 (0-177)
  Domains in SCOPe 2.08: d3q46a_
• Heterogens: PO4, MG, EPE, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3q46A (A:)
  mnpfhelepgpevpevvyalieipkgsrnkyeldkatgllkldrvlyspffypvdygiip
  qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
  disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee