PDB entry 3q31

View 3q31 on RCSB PDB site
Description: Structure of fungal alpha Carbonic Anhydrase from Aspergillus oryzae
Class: lyase
Keywords: Alpha Carbonic Anhydrase, Fungal Carbonic Anhydrase, glysosylation, Secreted, Dimeric, LYASE
Deposited on 2010-12-21, released 2011-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: AO090010000582
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3q31a_
  • Chain 'B':
    Compound: carbonic anhydrase
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: AO090010000582
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3q31b_
  • Heterogens: ZN, NAG, MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q31A (A:)
    aagglddankfnytglggplnwygldeaneacakgkhqspividsaaidyaasgslkldl
    pladgsklenlgfglqvtltngsltansktytlaqfhfhtpsehhvneehfpmevhfvfq
    taaketavvgfffqlsevgdsvplfdsvfapidnipdagtstttgqldfgglldhfnrhg
    vyqytgslttppcteevmwnlsteplpltvqgynkvkkiikynarytqnalgqdnlleva
    aqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q31A (A:)
    nkfnytglggplnwygldeaneacakgkhqspividsaaidyaasgslkldlpladgskl
    enlgfglqvtltngsltansktytlaqfhfhtpsehhvneehfpmevhfvfqtaaketav
    vgfffqlsevgdsvplfdsvfapidnipdagtstttgqldfgglldhfnrhgvyqytgsl
    ttppcteevmwnlsteplpltvqgynkvkkiikynarytqnalgqdnllevaaqkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q31B (B:)
    aagglddankfnytglggplnwygldeaneacakgkhqspividsaaidyaasgslkldl
    pladgsklenlgfglqvtltngsltansktytlaqfhfhtpsehhvneehfpmevhfvfq
    taaketavvgfffqlsevgdsvplfdsvfapidnipdagtstttgqldfgglldhfnrhg
    vyqytgslttppcteevmwnlsteplpltvqgynkvkkiikynarytqnalgqdnlleva
    aqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q31B (B:)
    nkfnytglggplnwygldeaneacakgkhqspividsaaidyaasgslkldlpladgskl
    enlgfglqvtltngsltansktytlaqfhfhtpsehhvneehfpmevhfvfqtaaketav
    vgfffqlsevgdsvplfdsvfapidnipdagtstttgqldfgglldhfnrhgvyqytgsl
    ttppcteevmwnlsteplpltvqgynkvkkiikynarytqnalgqdnllevaaqkl