PDB entry 3q2s

View 3q2s on RCSB PDB site
Description: Crystal Structure of CFIm68 RRM/CFIm25 complex
Class: nuclear protein
Keywords: CFIm, CFIm25, CFIm68, CPSF5, CPSF6, CPSF, 3' end processing, RNA processing, cleavage factor, Nudix protein, protein-protein complex, RRM domain, nudix fold, RNA, NUCLEAR PROTEIN
Deposited on 2010-12-20, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CFIM25, CPSF25, CPSF5, NUDT21, or CPSF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CFIM25, CPSF25, CPSF5, NUDT21, or CPSF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CFIM68, CPSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630
      • engineered mutation (146)
    Domains in SCOPe 2.07: d3q2sc_
  • Chain 'D':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CFIM68, CPSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630
      • engineered mutation (146)
    Domains in SCOPe 2.07: d3q2sd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q2sC (C:)
    dvgeefnqeaeygghdqidlyddvispsanngdapedrdymdtlpptvgddvgkgaapnv
    vytytgkrialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvg
    seasskklmdllpkrelhgqnpvvtpvnkqflsqfemqsrkttqsgqmsgegkagppggs
    sraafpqggrgrgrfpgavpggdrfpgpagpggppppfpagqthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q2sC (C:)
    ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
    mdllpkrelhgqnpvvtpvnkqflsqfemqsrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q2sD (D:)
    dvgeefnqeaeygghdqidlyddvispsanngdapedrdymdtlpptvgddvgkgaapnv
    vytytgkrialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvg
    seasskklmdllpkrelhgqnpvvtpvnkqflsqfemqsrkttqsgqmsgegkagppggs
    sraafpqggrgrgrfpgavpggdrfpgpagpggppppfpagqthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q2sD (D:)
    ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
    mdllpkrelhgqnpvvtpvnkqflsqfemqsr