PDB entry 3q2f
View 3q2f on RCSB PDB site
Description: Crystal Structure of the bromodomain of human BAZ2B in complex with a triazolo ligand
Class: transcription
Keywords: BAZB2, bromodomain adjacent to zinc finger domain, 2B, KIAA1476, WALp4, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on
2010-12-20, released
2011-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-01-26, with a file datestamp of
2011-01-21.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.196
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2B
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2B, KIAA1476
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3q2fa1, d3q2fa2 - Heterogens: OAM, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3q2fA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
Sequence, based on observed residues (ATOM records): (download)
>3q2fA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk