PDB entry 3q1s

View 3q1s on RCSB PDB site
Description: HIV-1 neutralizing antibody Z13e1 in complex with epitope display protein
Class: immune system/cytokine
Keywords: immunoglobulin fold, antibody, gp41, IMMUNE SYSTEM-CYTOKINE complex
Deposited on 2010-12-17, released 2011-11-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Z13e1 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q1S (0-End)
  • Chain 'I':
    Compound: Interleukin-22
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22, ILTIF, ZCYTO18, UNQ3099/PRO10096
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GZX6 (Start-150)
      • engineered mutation (35-37)
      • engineered mutation (39-40)
    Domains in SCOPe 2.04: d3q1si_
  • Chain 'L':
    Compound: Z13e1 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q1S (0-End)
    Domains in SCOPe 2.04: d3q1sl1, d3q1sl2
  • Heterogens: IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3q1sI (I:)
    qggaaapisshcrldksnfqqpyitnrtfmlakeawnwdditdvrligeklfhgvsmser
    cylmkqvlnftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqkl
    kdtvkklgesgeikaigeldllfmslrnaci
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q1sI (I:)
    crldksnmlakeawnwdditdvrligeklfhgvsmsercylmkqvlnftleevpflarls
    nrlstchiegddlhiqrnvqklkdtvkklgesgeikaigeldllfmslrnaci
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3q1sL (L:)
    eltqspatlslspgeratlscrasqsvgrnlgwyqqkpgqaprlliydasnratgiparf
    sgsgsgtdftltisslepedfavyycqarlllpqtfgqgtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q1sL (L:)
    eltqspatlslspgeratlscrasqsvgrnlgwyqqkpgqaprlliydasnratgiparf
    sgsgsgtdftltisslepedfavyycqarlllpqtfgqgtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnr