PDB entry 3q1h

View 3q1h on RCSB PDB site
Description: Crystal Structure of Dihydrofolate Reductase from Yersinia pestis
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha beta fold, cytosol, OXIDOREDUCTASE
Deposited on 2010-12-17, released 2011-01-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Yersinia pestis [TaxId:214092]
    Gene: folA, y3688, YPO0486, YP_3693
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CG83 (3-162)
      • expression tag (2)
    Domains in SCOPe 2.05: d3q1ha_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3q1hA (A:)
snamiisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpg
rlnivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthid
aevggdthfpdyepdewesvfsefhdadeanshsycfeilerr

    Sequence, based on observed residues (ATOM records): (download) 
    >3q1hA (A:)
amiisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrl
nivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidae
vggdthfpdyepdewesvfsefhdadeanshsycfeilerr