PDB entry 3q15

View 3q15 on RCSB PDB site
Description: Crystal Structure of RapH complexed with Spo0F
Class: hydrolase/kinase
Keywords: Tetratricopeptide repeat, 3-helix bundle, Phosphorelay signal transduction, Phosphatase, Response regulator receiver, HYDROLASE-KINASE complex
Deposited on 2010-12-16, released 2011-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator aspartate phosphatase H
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU06830, rapH, yeeH, yzqA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Response regulator aspartate phosphatase H
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU06830, rapH, yeeH, yzqA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU37130, spo0F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3q15c_
  • Chain 'D':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU37130, spo0F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3q15d_
  • Heterogens: GOL, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q15C (C:)
    gsmmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkip
    gmdgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkky
    lplksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q15C (C:)
    ekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdgi
    eilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q15D (D:)
    gsmmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkip
    gmdgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkky
    lplksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q15D (D:)
    ekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdgi
    eilkrmkvidenirviimtlthfakpfdideirdavkkyl