PDB entry 3q02

View 3q02 on RCSB PDB site
Description: Crystal structure of plasminogen activator inhibitor-1 in a metastable active conformation.
Class: hydrolase inhibitor
Keywords: PAI-1, active serpin, serine protease inhibitor, metastable conformation, HYDROLASE INHIBITOR
Deposited on 2010-12-15, released 2011-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAI1, PLANH1, SERPINE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (174)
    Domains in SCOPe 2.06: d3q02a_
  • Chain 'B':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAI1, PLANH1, SERPINE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (0-378)
      • engineered mutation (174)
    Domains in SCOPe 2.06: d3q02b_
  • Heterogens: CL, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q02A (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvaqalqkvkievnesgtvassstavivsarmapeeiimdrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q02A (A:)
    syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
    iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
    fseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfpdssth
    rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
    plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
    ftslsdqeplhvaqalqkvkievnesapeeiimdrpflfvvrhnptgtvlfmgqvmep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q02B (B:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvaqalqkvkievnesgtvassstavivsarmapeeiimdrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q02B (B:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqfktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvaqalqkvkievnespeeiimdrpflfvvrhnptgtvlfmgqvm
    ep