PDB entry 3pzw

View 3pzw on RCSB PDB site
Description: Soybean lipoxygenase-1 - re-refinement
Class: oxidoreductase
Keywords: dioxygenase, lipoxygenase, metalloprotein, oxidoreductase
Deposited on 2010-12-14, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.15
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • conflict (159)
    Domains in SCOPe 2.07: d3pzwa1, d3pzwa2
  • Heterogens: FE2, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pzwA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzwA (A:)
    hkikgtvvlmpknelnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlg
    agesafnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntklyks
    vriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyndlgnpdkse
    klarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigt
    kslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrt
    dgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdq
    sskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflre
    dgtlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmsh
    wlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflp
    skysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwa
    aiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevc
    liiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtit
    sklptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrr
    nndpslqgnrlgpvqlpytllypsseegltfrgipnsisi