PDB entry 3pzr

View 3pzr on RCSB PDB site
Description: Crystals structure of aspartate beta-Semialdehyde dehydrogenase from Vibrio Cholerae with NADP and product of S-carbamoyl-L-cysteine
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: NADP, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-12-14, released 2012-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_2036
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pzra1, d3pzra2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_2036
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pzrb1, d3pzrb2
  • Heterogens: CYS, NAP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pzrA (A:)
    mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
    slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
    gihhgtktfvggnctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgv
    indavsselanpassildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqske
    ewkagveankilglqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathnd
    wvkvipnerditareltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwgaaeplr
    rtlriilaek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pzrB (B:)
    mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
    slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
    gihhgtktfvggnctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgv
    indavsselanpassildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqske
    ewkagveankilglqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathnd
    wvkvipnerditareltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwgaaeplr
    rtlriilaek