PDB entry 3pzl

View 3pzl on RCSB PDB site
Description: The crystal structure of agmatine ureohydrolase of Thermoplasma volcanium
Class: hydrolase
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2010-12-14, released 2011-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agmatine ureohydrolase
    Species: Thermoplasma volcanium GSS1 [TaxId:273116]
    Gene: TV0538, TVG0528110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pzla_
  • Chain 'B':
    Compound: Agmatine ureohydrolase
    Species: Thermoplasma volcanium GSS1 [TaxId:273116]
    Gene: TV0538, TVG0528110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pzlb_
  • Chain 'C':
    Compound: Agmatine ureohydrolase
    Species: Thermoplasma volcanium GSS1 [TaxId:273116]
    Gene: TV0538, TVG0528110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pzlc_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pzlA (A:)
    mslggngrekdhaselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapds
    irgayvnlesyeysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipiml
    ggehsitvgavralpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsig
    irsvsreefedpdfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapa
    vgtpepfgladtdvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasreky
    ykehieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzlA (A:)
    aselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapdsirgayvnlesye
    ysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipimlggehsitvgavr
    alpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsigirsvsreefedp
    dfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapavgtpepfgladt
    dvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasrekyyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pzlB (B:)
    mslggngrekdhaselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapds
    irgayvnlesyeysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipiml
    ggehsitvgavralpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsig
    irsvsreefedpdfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapa
    vgtpepfgladtdvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasreky
    ykehieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzlB (B:)
    aselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapdsirgayvnlesye
    ysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipimlggehsitvgavr
    alpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsigirsvsreefedp
    dfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapavgtpepfgladt
    dvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasrekyykehi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pzlC (C:)
    mslggngrekdhaselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapds
    irgayvnlesyeysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipiml
    ggehsitvgavralpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsig
    irsvsreefedpdfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapa
    vgtpepfgladtdvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasreky
    ykehieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzlC (C:)
    aselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapdsirgayvnlesye
    ysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipimlggehsitvgavr
    alpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsigirsvsreefedp
    dfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapavgtpepfgladt
    dvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasrekyyk