PDB entry 3pzk

View 3pzk on RCSB PDB site
Description: Crystal Structure of the Mycobacterium tuberculosis crotonase in apo form
Class: lyase
Keywords: Structural Genomics, TB Structural Genomics Consortium, TBSGC, Crotonase, Enoyl CoA hydratase, LYASE
Deposited on 2010-12-14, released 2011-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e enoyl-CoA hydratase echA8
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA8, MT1100, MTV017.23c, Rv1070c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pzka_
  • Chain 'B':
    Compound: e enoyl-CoA hydratase echA8
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA8, MT1100, MTV017.23c, Rv1070c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pzkb_
  • Chain 'C':
    Compound: e enoyl-CoA hydratase echA8
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA8, MT1100, MTV017.23c, Rv1070c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pzkc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pzkA (A:)
    mtyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsaka
    faagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvli
    aadtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvv
    paddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqs
    egmaafiekrapqfthr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzkA (A:)
    tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
    aagadikftadffatwgklaavrtptiaavagyalgggcelammcdvliaadtakfgqpe
    iklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvpaddllteara
    tattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqsegmaafiekra
    pqft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pzkB (B:)
    mtyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsaka
    faagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvli
    aadtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvv
    paddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqs
    egmaafiekrapqfthr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzkB (B:)
    tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
    aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
    adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
    addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
    gmaafiekrapqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pzkC (C:)
    mtyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsaka
    faagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvli
    aadtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvv
    paddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqs
    egmaafiekrapqfthr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzkC (C:)
    yetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakafa
    agadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvliaa
    dtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvpa
    ddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqseg
    maafiekrapqf