PDB entry 3pze

View 3pze on RCSB PDB site
Description: JNK1 in complex with inhibitor
Class: transferase/transferase inhibitor
Keywords: kinase JNK1, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-12-14, released 2011-12-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK8, JNK1, PRKM8, SAPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pzea_
  • Heterogens: SO4, CFK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pzeA (A:)
    dnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqth
    akrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyv
    vtryyrapevilgmgykenvdlwsvgcimgemvchkilfpgrdyidqwnkvieqlgtpcp
    efmkklqptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvida
    skrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykevmdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzeA (A:)
    dnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqth
    akrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglsfmmtvtryyrape
    vilgmgykenvdlwsvgcimgemvchkilfpgrdyidqwnkvieqlgtpcpefmkklqpt
    vrtyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvidaskrisvdea
    lqhpyinvwydpseaeapppkipdkqlderehtieewkeliykevmd