PDB entry 3pz4

View 3pz4 on RCSB PDB site
Description: Crystal structure of FTase(ALPHA-subunit; BETA-subunit DELTA C10) in complex with BMS3 and lipid substrate FPP
Class: transferase/transferase inhibitor
Keywords: protein prenylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-12-14, released 2011-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.227
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta, Ggta, Rabggta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pz4a_
  • Chain 'B':
    Compound: Protein farnesyltransferase subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fntb, Ggtb, Rabggtb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pz4b_
  • Heterogens: ZN, FPP, 3PZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pz4A (A:)
    ghmaategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflsl
    dsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafk
    ltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvew
    lkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwn
    qrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnq
    lldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywry
    igrslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz4A (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pz4B (B:)
    assssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfss
    ykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqi
    vatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekllqyl
    yslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggigg
    vpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcys
    fwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfy
    htcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvp
    gfeece
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz4B (B:)
    eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
    ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggf
    gggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd
    vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
    ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
    palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
    mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf