PDB entry 3pz4

View 3pz4 on RCSB PDB site
Description: Crystal structure of FTase(ALPHA-subunit; BETA-subunit DELTA C10) in complex with BMS3 and lipid substrate FPP
Class: transferase/transferase inhibitor
Keywords: protein prenylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-12-14, released 2011-05-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61239
      • conflict (86)
      • conflict (157)
      • conflict (195)
      • conflict (319)
      • conflict (369)
  • Chain 'B':
    Compound: Protein farnesyltransferase subunit beta
    Species: Mus musculus [TaxId:10090]
    Gene: Fntb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K2I1
      • conflict (29)
      • conflict (70)
      • conflict (383)
      • conflict (404)
    Domains in SCOPe 2.03: d3pz4b_
  • Heterogens: ZN, FPP, 3PZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pz4B (B:)
    assssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfss
    ykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqi
    vatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekllqyl
    yslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggigg
    vpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcys
    fwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfy
    htcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvp
    gfeece
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz4B (B:)
    eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
    ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggf
    gggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd
    vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
    ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
    palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
    mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf