PDB entry 3pz3

View 3pz3 on RCSB PDB site
Description: Crystal structure of RabGGTase(DELTA LRR; DELTA IG) in Complex with BMS-analogue 14
Class: transferase/transferase inhibitor
Keywords: protein prenylation, fusion protein, chimera protein, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-12-14, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl transferase type-2 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rabggta, Ggta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08602 (Start-238)
      • linker (239-242)
    • Uniprot Q08602 (243-331)
  • Chain 'B':
    Compound: Geranylgeranyl transferase type-2 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rabggtb, Ggtb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pz3b_
  • Heterogens: ZN, CA, PZ3, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pz3B (B:)
    gtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmg
    qlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvva
    yvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggf
    gcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcy
    swwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsll
    geeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz3B (B:)
    qkdvtiksdapdtlllekhadyiasygsdyeycmseylrmsgvywgltvmdlmgqlhrmn
    keeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslq
    kedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgs
    eshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvla
    slkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqik
    pvspvfcmpeevlqrvnvqpelvs