PDB entry 3pz1

View 3pz1 on RCSB PDB site
Description: Crystal structure of RabGGTase(DELTA LRR; DELTA IG) in Complex with BMS3
Class: transferase/transferase inhibitor
Keywords: protein prenylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-12-14, released 2011-05-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl transferase type-2 subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Rabggta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JHK4 (Start-238)
      • conflict (41)
      • conflict (76)
      • conflict (80)
      • conflict (86)
      • conflict (211)
      • linker (239-240)
    • Uniprot Q9JHK4 (Start-331)
  • Chain 'B':
    Compound: Geranylgeranyl transferase type-2 subunit beta
    Species: Mus musculus [TaxId:10090]
    Gene: Rabggtb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53612 (Start-329)
      • conflict (66)
      • conflict (83)
      • conflict (109)
      • conflict (220)
      • conflict (226)
      • conflict (231)
      • conflict (257-258)
    Domains in SCOPe 2.03: d3pz1b_
  • Heterogens: 3PZ, ZN, CA, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pz1B (B:)
    gtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmg
    qlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvva
    yvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggf
    gcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcy
    swwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsll
    geeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz1B (B:)
    qkdvtiksdapdtlllekhadyiasygsdyeycmseylrmsgvywgltvmdlmgqlhrmn
    keeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslq
    kedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgs
    eshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvla
    slkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqik
    pvspvfcmpeevlqrvnvqpelvs