PDB entry 3pyy

View 3pyy on RCSB PDB site
Description: Discovery and Characterization of a Cell-Permeable, Small-molecule c-Abl Kinase Activator that Binds to the Myristoyl Binding Site
Class: Transferase
Keywords: Tyrosine kinase, Transferase
Deposited on 2010-12-13, released 2011-03-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.189
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-abl Abelson murine leukemia viral oncogene homolog 1 isoform b variant
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3pyya_
  • Chain 'B':
    Compound: V-abl Abelson murine leukemia viral oncogene homolog 1 isoform b variant
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3pyyb_
  • Heterogens: SO4, STI, 3YY, 2PE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pyyA (A:)
    mhhhhhhenlyfqgspnydkwemertditmkhklgggqygevyegvwkkysltvavktlk
    edtmeveeflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqe
    vnavvllymatqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtyt
    ahagakfpikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellek
    dyrmerpegcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pyyA (A:)
    ydkwemertditmkhklgggqygevyegvwkkysltvavktlkeveeflkeaavmkeikh
    pnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyle
    kknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynk
    fsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmrac
    wqwnpsdrpsfaeihqafetmfqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pyyB (B:)
    mhhhhhhenlyfqgspnydkwemertditmkhklgggqygevyegvwkkysltvavktlk
    edtmeveeflkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqe
    vnavvllymatqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtyt
    ahagakfpikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellek
    dyrmerpegcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pyyB (B:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlveeflkeaavmkeikhpnl
    vqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekkn
    fihrdlaarnclvgenhlvkvadfgakfpikwtapeslaynkfsiksdvwafgvllweia
    tygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeihqaf
    etmfqessisdevekel