PDB entry 3py3

View 3py3 on RCSB PDB site
Description: Crystal structure of phosphorylated p38alpha MAP kinase
Class: transferase
Keywords: Kinase, Transferase, Phosphorylation
Deposited on 2010-12-11, released 2011-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47811 (20-End)
      • expression tag (17-19)
    Domains in SCOPe 2.06: d3py3a1, d3py3a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3py3A (A:)
    mgsshhhhhhssglvprgshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvca
    afdtktghrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefn
    dvylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavne
    dcelkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgr
    tlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqslaqmpkmnfanvfiganpl
    avdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksl
    tydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3py3A (A:)
    gshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsr
    pfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnniv
    kcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdd
    emtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilr
    lvgtpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkri
    taaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld