PDB entry 3pxu

View 3pxu on RCSB PDB site
Description: Crystal structure of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei bound to dephospho-coenzyme A
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, HUMAN AND ANIMAL PATHOGEN, MELIOIDOSIS, ATP-BINDING, COENZYME A BIOSYNTHESIS, NUCLEOTIDE-BINDING, NUCLEOTIDYLTRANSFERASE, TRANSFERASE, PPAT, pantetheine-phosphate adenylyltransferase
Deposited on 2010-12-10, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_0748, coaD, coaD BURPS1710B_0748
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JW91 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d3pxua1, d3pxua2
  • Heterogens: COD, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pxuA (A:)
    gpgsmvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkiane
    vlghypnvkvmgftgllkdfvrandarvivrglravsdfeyefqmagmnryllpdvetmf
    mtpsdqyqfisgtivreiaqlggdvskfvfpsvekwltekvaamaqgpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxuA (A:)
    smvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevlg
    hypnvkvmgftgllkdfvrandarvivrglrafeyefqmagmnryllpdvetmfmtpsdq
    yqfisgtivreiaqlggdvskfvfpsvekwltekvaama