PDB entry 3pxk

View 3pxk on RCSB PDB site
Description: FOCAL ADHESION KINASE CATALYTIC DOMAIN IN COMPLEX WITH Pyrrolo[2,3-d]thiazole
Class: transferase
Keywords: tyrosine protein kinase, transferase, ATP binding
Deposited on 2010-12-10, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTK2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pxka_
  • Chain 'B':
    Compound: PTK2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pxkb_
  • Heterogens: PXK, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pxkA (A:)
    gsgstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaqqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxkA (A:)
    yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
    mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
    ayleskrfvhrdiaarnvlvssndcvklgdfglpikwmapesinfrrftsasdvwmfgvc
    mweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprfte
    lkaqlstileeekaqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pxkB (B:)
    gsgstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaqqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxkB (B:)
    dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
    tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
    layleskrfvhrdiaarnvlvssndcvklgdfgllpikwmapesinfrrftsasdvwmfg
    vcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprf
    telkaqlstileeekaqq