PDB entry 3px8

View 3px8 on RCSB PDB site
Description: RTA in complex with 7-carboxy-pterin
Class: hydrolase/inhibitor
Keywords: Ricin, toxin, protein-ligand complex, hydrolase, ribosome inactivating protein, N-glycosidase, pterin, hydrolase-inhibitor complex
Deposited on 2010-12-09, released 2011-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Preproricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3px8x_
  • Heterogens: JP2, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3px8X (X:)
    kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
    nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
    drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
    iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
    dvsilipiialmvyrcap