PDB entry 3pwk

View 3pwk on RCSB PDB site
Description: Crystal Structure of Aspartate beta-Semialdehide Dehydrogenase from Streptococcus pneumoniae with 2',5'-Adenosine diphosphate and D-2-aminoadipate
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Dehydrogenase, NADP Binding, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-12-08, released 2012-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.132
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:406563]
    Gene: CGSSp23BS72_03388
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pwka1, d3pwka2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:406563]
    Gene: CGSSp23BS72_03388
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5MTN0 (Start-357)
      • expression tag (358-359)
    Domains in SCOPe 2.06: d3pwkb1, d3pwkb2, d3pwkb3
  • Heterogens: 25A, L14, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pwkA (A:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pwkA (A:)
    gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
    fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
    iiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvk
    pcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsa
    tcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrd
    tfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pwkB (B:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pwkB (B:)
    gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
    fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
    iiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvk
    pcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsa
    tcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrd
    tfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle