PDB entry 3pwi

View 3pwi on RCSB PDB site
Description: Crystal structure of the mutant P34A of D-Glucarate dehydratase from Escherichia coli complexed with product 5-keto-4-deoxy-D-Glucarate
Class: lyase
Keywords: Enolase superfamily fold, D-Glucarate dehydratase, 5-keto-4-deoxy-D-Glucarate, LYASE
Deposited on 2010-12-08, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:444449]
    Gene: ECH74042_A2717
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2KTD9 (Start-445)
      • engineered mutation (33)
    Domains in SCOPe 2.07: d3pwia1, d3pwia2
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Escherichia coli [TaxId:444449]
    Gene: ECH74042_A2717
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2KTD9 (Start-445)
      • engineered mutation (33)
    Domains in SCOPe 2.07: d3pwib1, d3pwib2
  • Heterogens: MG, GLR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pwiA (A:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahaafftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pwiA (A:)
    tpvvtemqvipvaghdsmlmnlsgahaafftrniviikdnsghtgvgeipggekirktle
    daiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldllgq
    hlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpd
    avvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneai
    kigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqs
    vdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaid
    thwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddam
    gmqylipgwtfdnkrpcmvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pwiB (B:)
    mssqfttpvvtemqvipvaghdsmlmnlsgahaafftrniviikdnsghtgvgeipggek
    irktledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaam
    ldllgqhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrhe
    eamtpdavvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngaw
    slneaikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmgh
    tlslqsvdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapg
    kitaidthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglg
    arddamgmqylipgwtfdnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pwiB (B:)
    ttpvvtemqvipvaghdsmlmnlsgahaafftrniviikdnsghtgvgeipggekirktl
    edaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldllg
    qhlgvnvasllgdgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtp
    davvrlaeaayekygfndfklkggvlageeeaesivalaqrfpqaritldpngawslnea
    ikigkylkgslayaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslq
    svdipladphfwtmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitai
    dthwiwqegnqrltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgardda
    mgmqylipgwtfdnkrpcmvr