PDB entry 3pwf

View 3pwf on RCSB PDB site
Description: High resolution structure of the fully reduced form of rubrerythrin from P. furiosus
Class: oxidoreductase
Keywords: Non heme iron peroxidases, oxidative stress, rubrerythrin, OXIDOREDUCTASE
Deposited on 2010-12-08, released 2011-06-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.167
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pwfa1, d3pwfa2
  • Chain 'B':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pwfb1, d3pwfb2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pwfA (A:)
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pwfB (B:)
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe