PDB entry 3pwc

View 3pwc on RCSB PDB site
Description: Bovine trypsin variant X(tripleGlu217Ile227) in complex with small molecule inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: trypsin-like serine protease, hydrolase, protein binding, duodenum, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-12-08, released 2011-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.147
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (171)
      • engineered mutation (194)
      • engineered mutation (204)
    Domains in SCOPe 2.08: d3pwca_
  • Heterogens: CA, ANH, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pwcA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdsggp
    vvcsgklqgivswgegcaqknkpgiytkvcnyvswikqtiasn