PDB entry 3pvk

View 3pvk on RCSB PDB site
Description: Secreted aspartic protease 2 in complex with benzamidine
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-12-07, released 2011-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: 0.169
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Candidapepsin-2
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pvka_
  • Heterogens: ZN, BAM, MPD, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pvkA (A:)
    qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnvdcqvtysdqtadfck
    qkgtydpsgssasqdlntpfkigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
    qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdaatgqiifggvdnakys
    gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
    kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasefaaslqgddgqpydkcqllfdv
    ndanilgdnflrsayivydlddneislaqvkytsassisalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pvkA (A:)
    avpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnvdcqvtysdqtadfckq
    kgtydpsgssasqdlntpfkigygdgsssqgtlykdtvgfggvsiknqvladvdstsidq
    gilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdaatgqiifggvdnakysg
    slialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafngk
    ltqdsngnsfyevdcnlsgdvvfnfsknakisvpasefaaskcqllfdvndanilgdnfl
    rsayivydlddneislaqvkytsassisal