PDB entry 3pvi

View 3pvi on RCSB PDB site
Description: d34g mutant of pvuii endonuclease complexed with cognate dna shows that asp34 is directly involved in dna recognition and indirectly involved in catalysis
Deposited on 1998-10-09, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.205
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3pvia_
  • Chain 'B':
    Domains in SCOP 1.55: d3pvib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pviA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqgnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pviB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqgnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy