PDB entry 3pve

View 3pve on RCSB PDB site
Description: Crystal structure of the G2 domain of Agrin from Mus Musculus
Class: transcription
Keywords: mRNA splicing, STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, New York SGX Research Center for Structural Genomics, TRANSCRIPTION
Deposited on 2010-12-07, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agrin, Agrin protein
    Species: Mus musculus [TaxId:10090]
    Gene: Agrin, Agrin (NP_067617)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pvea_
  • Chain 'B':
    Compound: Agrin, Agrin protein
    Species: Mus musculus [TaxId:10090]
    Gene: Agrin, Agrin (NP_067617)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pveb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pveA (A:)
    slenagsrpfladfngfsylelkglhtferdlgekmalemvflargpsglllyngqktdg
    kgdfvslalhnrhlefrydlgkgaaiirskepialgtwvrvflerngrkgalqvgdgprv
    lgespvphtmlnlkeplyvggapdfsklargaavasgfdgaiqlvslrghqlltqehvlr
    avdvapfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pveA (A:)
    srpfladfngfsylelkglhtfmalemvflargpsglllyngqktgkgdfvslalhnrhl
    efrydlgkgaaiirskepialgtwvrvflerngrkgalqvgdgprvlgespvphtmlnlk
    eplyvggapdfsklargaavasgfdgaiqlvslrghqlltqehvlravdvapfag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pveB (B:)
    slenagsrpfladfngfsylelkglhtferdlgekmalemvflargpsglllyngqktdg
    kgdfvslalhnrhlefrydlgkgaaiirskepialgtwvrvflerngrkgalqvgdgprv
    lgespvphtmlnlkeplyvggapdfsklargaavasgfdgaiqlvslrghqlltqehvlr
    avdvapfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pveB (B:)
    srpfladfngfsylelkglhtfkmalemvflargpsglllyngqktdgkgdfvslalhnr
    hlefrydlgkgaaiirskepialgtwvrvflerngrkgalqvgdgprvlgespvphtmln
    lkeplyvggapdfsklargaavasgfdgaiqlvslhqlltqehvlravdvap