PDB entry 3pud

View 3pud on RCSB PDB site
Description: Crystal structure of Dhydrodipicolinate synthase from Acinetobacter baumannii at 2.8A resolution
Class: lyase
Keywords: LYASE, TIM barrel,beta-alpha-barrel, Diaminopimelate biosynthesis, Lysine biosynthesis
Deposited on 2010-12-04, released 2010-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: DHDPS, HMPREF0010_03414
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3puda_
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: DHDPS, HMPREF0010_03414
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pudb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pudA (A:)
    tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
    keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
    aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
    mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
    nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pudB (B:)
    tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
    keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
    aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
    mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
    nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii