PDB entry 3ptl

View 3ptl on RCSB PDB site
Description: Crystal structure of proteinase K inhibited by a lactoferrin nonapeptide, Lys-Gly-Glu-Ala-Asp-Ala-Leu-Ser-Leu-Asp at 1.3 A resolution.
Class: hydrolase/inhibitor
Keywords: HYDROLASE-INHIBITOR complex
Deposited on 2010-12-03, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.202
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Engyodontium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ptla_
  • Chain 'B':
    Compound: 10-mer peptide from Lactoferrin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ptlA (A:)
    aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
    yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
    rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
    gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
    gkttaasacryiadtankgdlsnipfgtvnllaynnyqa
    

  • Chain 'B':
    No sequence available.