PDB entry 3pta

View 3pta on RCSB PDB site
Description: Crystal structure of human DNMT1(646-1600) in complex with DNA
Class: Transferase/DNA
Keywords: DNMT1, Maintenance DNA methylation, Transferase-DNA complex
Deposited on 2010-12-02, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.257
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (cytosine-5)-methyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DNMT1, AIM, CXXC9, DNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ptaa1, d3ptaa2, d3ptaa3, d3ptaa4, d3ptaa5
  • Chain 'B':
    Compound: DNA (5'-d(*tp*cp*cp*cp*gp*tp*gp*ap*gp*cp*cp*tp*cp*cp*gp*cp*ap*gp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*cp*tp*gp*cp*gp*gp*ap*gp*gp*cp*tp*cp*ap*cp*gp*gp*gp*a)-3')
  • Heterogens: SAH, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ptaA (A:)
    snafkrrrcgvcevcqqpecgkckackdmvkfggsgrskqacqerrcpnmamkeadddee
    vddnipempspkkmhqgkkkkqnknriswvgeavktdgkksyykkvcidaetlevgdcvs
    vipddsskplylarvtalwedssngqmfhahwfcagtdtvlgatsdplelflvdecedmq
    lsyihskvkviykapsenwameggmdpesllegddgktyfyqlwydqdyarfesppktqp
    tednkfkfcvscarlaemrqkeiprvleqledldsrvlyysatkngilyrvgdgvylppe
    aftfniklsspvkrprkepvdedlypehyrkysdyikgsnldapepyrigrikeifcpkk
    sngrpnetdikirvnkfyrpenthkstpasyhadinllywsdeeavvdfkavqgrctvey
    gedlpecvqvysmggpnrfyfleaynaksksfedppnharspgnkgkgkgkgkgkpksqa
    cepsepeieiklpklrtldvfsgcgglsegfhqagisdtlwaiemwdpaaqafrlnnpgs
    tvftedcnillklvmagettnsrgqrlpqkgdvemlcggppcqgfsgmnrfnsrtyskfk
    nslvvsflsycdyyrprffllenvrnfvsfkrsmvlkltlrclvrmgyqctfgvlqagqy
    gvaqtrrraiilaaapgeklplfpeplhvfapracqlsvvvddkkfvsnitrlssgpfrt
    itvrdtmsdlpevrngasaleisyngepqswfqrqlrgaqyqpilrdhickdmsalvaar
    mrhiplapgsdwrdlpnievrlsdgtmarklrythhdrkngrsssgalrgvcscveagka
    cdpaarqfntlipwclphtgnrhnhwaglygrlewdgffsttvtnpepmgkqgrvlhpeq
    hrvvsvrecarsqgfpdtyrlfgnildkhrqvgnavppplakaigleiklcmlaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ptaA (A:)
    afkrrrcgvcevcqqpecgkckackdmvkfggsgrskqacqerrcpnmamkeadddeevd
    dnipempspkkmhqgkkkkqnknriswvgeavktdgkksyykkvcidaetlevgdcvsvi
    pddsskplylarvtalwedssngqmfhahwfcagtdtvlgatsdplelflvdecedmqls
    yihskvkviykapsenwameggmdpgktyfyqlwydqdyarfesppktqptednkfkfcv
    scarlaemrqkeiprvleqledldsrvlyysatkngilyrvgdgvylppeaftfniklss
    pkepvdedlypehyrkysnldapepyrigrikeifcpkksngrpnetdikirvnkfyrpe
    nthkstpasyhadinllywsdeeavvdfkavqgrctveygedlpecvqvysmggpnrfyf
    leaynaksksfedppnharspgklpklrtldvfsgcgglsegfhqagisdtlwaiemwdp
    aaqafrlnnpgstvftedcnillklvmagettnsrgqrlpqkgdvemlcggppcqgfsgm
    nrfnsrtyskfknslvvsflsycdyyrprffllenvrnfvsfkrsmvlkltlrclvrmgy
    qctfgvlqagqygvaqtrrraiilaaapgeklplfpeplhvfapracqlsvvvddkkfvs
    nitrlssgpfrtitvrdtmsdlpevrngasaleisyngepqswfqrqlrgaqyqpilrdh
    ickdmsalvaarmrhiplapgsdwrdlpnievrlsdgtmarklrythhdrkngrsssgal
    rgvcscvacdpaarqfntlipwclphtgnrhnhwaglygrlewdgffsttvtnpepmgkq
    grvlhpeqhrvvsvrecarsqgfpdtyrlfgnildkhrqvgnavppplakaigleiklcm
    laka
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.