PDB entry 3pt9

View 3pt9 on RCSB PDB site
Description: Crystal structure of mouse DNMT1(731-1602) in the free state
Class: Transferase
Keywords: Maintenance DNA methylation, Transferase
Deposited on 2010-12-02, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (cytosine-5)-methyltransferase 1
    Species: Mus musculus [TaxId:10090]
    Gene: Dnmt1, Dnmt, Met1, Uim
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13864 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3pt9a1, d3pt9a2, d3pt9a3, d3pt9a4
  • Heterogens: SAH, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pt9A (A:)
    skdriswlgqpmkieenrtyyqkvsideemlevgdcvsvipddsskplylarvtalwedk
    ngqmmfhahwfcagtdtvlgatsdplelflvgecenmqlsyihskvkviykapsenwame
    ggtdpettlpgaedgktyffqlwynqeyarfesppktqptednkhkfclscirlaelrqk
    empkvleqieevdgrvycssitkngvvyrlgdsvylppeaftfnikvaspvkrpkkdpvn
    etlypehyrkysdyikgsnldapepyrigrikeihcgkkkgkvneadiklrlykfyrpen
    thrsyngsyhtdinmlywsdeeavvnfsdvqgrctveygedllesiqdysqggpdrfyfl
    eaynsktknfedppnharspgnkgkgkgkgkgkgkhqvsepkepeaaiklpklrtldvfs
    gcgglsegfhqagisetlwaiemwdpaaqafrlnnpgttvftedcnvllklvmagevtns
    lgqrlpqkgdvemlcggppcqgfsgmnrfnsrtyskfknslvvsflsycdyyrprfflle
    nvrnfvsyrrsmvlkltlrclvrmgyqctfgvlqagqygvaqtrrraiilaaapgeklpl
    fpeplhvfapracqlsvvvddkkfvsnitrlssgpfrtitvrdtmsdlpeiqngasnsei
    pyngeplswfqrqlrgshyqpilrdhickdmsplvaarmrhiplfpgsdwrdlpniqvrl
    gdgviahklqytfhdvkngysstgalrgvcscaegkacdpesrqfstlipwclphtgnrh
    nhwaglygrlewdgffsttvtnpepmgkqgrvlhpeqhrvvsvrecarsqgfpdsyrffg
    nildrhrqvgnavppplakaigleiklcllssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pt9A (A:)
    skdriswlgqpmkieenrtyyqkvsideemlevgdcvsvipddsskplylarvtalwedk
    ngqmmfhahwfcagtdtvlgatsdplelflvgecenmqlsyihskvkviykapsenwame
    gktyffqlwynqeyarfesppktqptednkhkfclscirlaelrqkempkvleqieevdg
    rvycssitkngvvyrlgdsvylppeaftfnikvaspvkrpkkdpvnetlypehyrkysld
    apepyrigrikeihcgkkkgkvneadiklrlykfyrpenthrsyngsyhtdinmlywsde
    eavvnfsdvqgrctveygedllesiqdysqggpdrfyfleaynsktknfedppnharspg
    iklpklrtldvfsgcgglsegfhqagisetlwaiemwdpaaqafrlnnpgttvftedcnv
    llklvmagevtnslgqrlpqkgdvemlcggppcqgfsgmnrfnsrtyskfknslvvsfls
    ycdyyrprffllenvrnfvsyrrsmvlkltlrclvrmgyqctfgvlqagqygvaqtrrra
    iilaaapgeklplfpeplhvfapracqlsvvvddkkfvsnitrlssgpfrtitvrdtmsd
    lpeiqngasnseipyngeplswfqrqlrgshyqpilrdhickdmsplvaarmrhiplfpg
    sdwrdlpniqvrlgdgviahklqytfhdvkngysstgalrgvcscaegkacdpesrqfst
    lipwclphtgnrhnhwaglygrlewdgffsttvtnpepmgkqgrvlhpeqhrvvsvreca
    rsqgfpdsyrffgnildrhrqvgnavppplakaigleiklclls