PDB entry 3psy

View 3psy on RCSB PDB site
Description: Endothiapepsin in complex with an inhibitor based on the Gewald reaction
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-12-02, released 2011-12-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.128
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3psya_
  • Heterogens: RB9, DMS, GOL, PG4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3psyA (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask