PDB entry 3psw

View 3psw on RCSB PDB site
Description: Structure of E97Q mutant of TIM from Plasmodium falciparum
Class: isomerase
Keywords: TIM barrel, Isomerase
Deposited on 2010-12-02, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.203
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (96)
      • engineered mutation (162)
    Domains in SCOPe 2.07: d3pswa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (96)
      • engineered mutation (162)
    Domains in SCOPe 2.07: d3pswb_
  • Heterogens: EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pswA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighfqrrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pswA (A:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighfqrrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pswB (B:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighfqrrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pswB (B:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighfqrrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam