PDB entry 3psr

View 3psr on RCSB PDB site
Description: human psoriasin (s100a7) ca2+ bound form (crystal form I)
Class: ef-hand protein
Keywords: ca-binding, psoriasis, s100 protein family, x-ray crystallography, ef-hand protein
Deposited on 1998-09-17, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: psoriasin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3psra_
  • Chain 'B':
    Compound: psoriasin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3psrb_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3psrA (A:)
    sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
    kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3psrA (A:)
    sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
    kdknedkkidfseflsllgdiatdyhkqshgaapcs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3psrB (B:)
    sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
    kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3psrB (B:)
    sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
    kdknedkkidfseflsllgdiatdyhkqshgaapcs