PDB entry 3psg

View 3psg on RCSB PDB site
Description: the high resolution crystal structure of porcine pepsinogen
Class: hydrolase(acid proteinase zymogen)
Keywords: hydrolase(acid proteinase zymogen)
Deposited on 1991-09-03, released 1993-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.17
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepsinogen
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00791 (44-369)
      • conflict (62)
      • conflict (306)
    Domains in SCOPe 2.05: d3psga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3psgA (A:)
    lvkvplvrkkslrqnlikdgklkdflkthkhnpaskyfpeaaaligdeplenyldteyfg
    tigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpddsstfeatsqelsityg
    tgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgilglaypsisasgatpv
    fdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgslnwvpvsvegywqitlds
    itmdgetiacsggcqaivdtgtslltgptsaianiqsdigasensdgemviscssidslp
    divftidgvqyplspsayilqdddsctsgfegmdvptssgelwilgdvfirqyytvfdra
    nnkvglapva
    

    Sequence, based on observed residues (ATOM records): (download)
    >3psgA (A:)
    lvkvplvrkkslrqnlikdgklkdflkthkhnpaskyfpeaaaligdeplenyldteyfg
    tigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpddsstfeatsqelsityg
    tgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgilglaypsisasgatpv
    fdnlwdqglvsqdlfsvylsgsvvllggidssyytgslnwvpvsvegywqitldsitmdg
    etiacsggcqaivdtgtslltgptsaianiqsdigasensdgemviscssidslpdivft
    idgvqyplspsayilqdddsctsgfegmdvptssgelwilgdvfirqyytvfdrannkvg
    lapva