PDB entry 3pse

View 3pse on RCSB PDB site
Description: Structure of a viral OTU domain protease bound to interferon-stimulated gene 15 (ISG15)
Class: hydrolase/protein binding
Keywords: viral deubiquitinase, 3-aminopropane, intein-mediated ligation, Crimean-Congo Hemorrhagic Fever virus, HYDROLASE-PROTEIN BINDING complex
Deposited on 2010-12-01, released 2011-01-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.167
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase
    Species: Crimean-Congo hemorrhagic fever virus [TaxId:11593]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6TQF5 (2-End)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05161 (Start-155)
      • engineered mutation (77)
      • see remark 999 (82)
    Domains in SCOPe 2.03: d3pseb1, d3pseb2
  • Heterogens: 3CN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pseB (B:)
    mgwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvpl
    asqglgpgstvllvvdksdeplnilvrnnkgrsstyevrltqtvahlkqqvsglegvqdd
    lfwltfegkpledqlplgeyglkplstvfmnlrlrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pseB (B:)
    dltvkmlagnefqvslmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasqglg
    pgstvllvvdksdeplnilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltf
    egkpledqlplgeyglkplstvfmnlrlrg