PDB entry 3ps8
View 3ps8 on RCSB PDB site
Description: Crystal structure of L68V mutant of human cystatin C
Class: hydrolase inhibitor
Keywords: cysteine protease inhibitor, 3D domain swapping, Hereditary Cystatin C Amyloid Angiopathy, Protease inhibitor, HYDROLASE INHIBITOR
Deposited on
2010-12-01, released
2011-12-21
The last revision prior to the SCOPe 2.03 freeze date was dated
2013-04-03, with a file datestamp of
2013-03-29.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.191
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cystatin-C
Species: Homo sapiens [TaxId:9606]
Gene: CST3
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3ps8a_ - Heterogens: PEG, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3ps8A (A:)
sspgkpprlvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagv
nyfldvevgrttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
Sequence, based on observed residues (ATOM records): (download)
>3ps8A (A:)
gpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvevgrt
tctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda