PDB entry 3ps8

View 3ps8 on RCSB PDB site
Description: Crystal structure of L68V mutant of human cystatin C
Class: hydrolase inhibitor
Keywords: cysteine protease inhibitor, 3D domain swapping, Hereditary Cystatin C Amyloid Angiopathy, Protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2010-12-01, released 2011-12-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystatin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01034 (Start-119)
      • engineered mutation (67)
    Domains in SCOPe 2.03: d3ps8a_
  • Heterogens: PEG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ps8A (A:)
    sspgkpprlvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagv
    nyfldvevgrttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ps8A (A:)
    gpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvevgrt
    tctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda