PDB entry 3ps5

View 3ps5 on RCSB PDB site
Description: Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
Class: hydrolase, signaling protein
Keywords: SH2, PTP, Phosphatase, HYDROLASE, SIGNALING PROTEIN
Deposited on 2010-11-30, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.227
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN6, HCP, PTP1C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29350 (0-End)
      • engineered mutation (452)
    Domains in SCOPe 2.07: d3ps5a1, d3ps5a2, d3ps5a3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ps5A (A:)
    mvrwfhrdlsgldaetllkgrgvhgsflarpsrknqgdfslsvrvgdqvthiriqnsgdf
    ydlyggekfatltelveyytqqqgvlqdrdgtiihlkyplncsdptserwyhghmsggqa
    etllqakgepwtflvreslsqpgdfvlsvlsdqpkagpgsplrvthikvmceggrytvgg
    letfdsltdlvehfkktgieeasgafvylrqpyyatrvnaadienrvlelnkkqesedta
    kagfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsd
    yinanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnk
    cvpywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdh
    gvpsepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldc
    didiqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqkgqeseygnit
    yppamknahakasrtsskhkedvyenlhtknkreekvkkqrsadkekskgslkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ps5A (A:)
    mvrwfhrdlsgldaetllkgrgvhgsflarpsrknqgdfslsvrvgdqvthiriqnsgdf
    ydlyggekfatltelveyytqqqgvlqdrdgtiihlkyplncsdptserwyhghmsggqa
    etllqakgepwtflvreslsqpgdfvlsvlsdqpkagpgsplrvthikvmceggrytvgg
    letfdsltdlvehfkktgieeasgafvylrqpyyatrvnaadienrvlelnkkqesedta
    kagfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsd
    yinanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnk
    cvpywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdh
    gvpsepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldc
    didiqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsq