PDB entry 3prf

View 3prf on RCSB PDB site
Description: Crystal Structure of Human B-Raf Kinase Domain in Complex with a Non-Oxime Furopyridine Inhibitor
Class: transferase/transferase inhibitor
Keywords: Protein Kinase, ATP-competitive inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-11-29, released 2011-02-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.271
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3prfa_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3prfb_
  • Heterogens: FP3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3prfA (A:)
    mdrgshhhhhhgsedrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgd
    vavkmlnvtaptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyh
    hlhiietkfemiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglat
    vksrwsgshqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysni
    nnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellar
    slpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3prfA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvgsilwmapevirmqdknpysfqsdvya
    fgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkr
    derplfpqilasiellarslpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3prfB (B:)
    mdrgshhhhhhgsedrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgd
    vavkmlnvtaptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyh
    hlhiietkfemiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglat
    vksrwsgshqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysni
    nnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellar
    slpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3prfB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvgsilwmapevirmqdknpysfqsdvya
    fgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkr
    derplfpqilasiellarslpk