PDB entry 3pr1

View 3pr1 on RCSB PDB site
Description: Crystal structure of apo Thermotoga maritima ribosome biogenesis GTP-binding protein EngB
Class: hydrolase
Keywords: Rossmann fold, Hydrolase, GTP Binding, cell cycle
Deposited on 2010-11-29, released 2011-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTP-binding protein engB
    Species: Thermotoga maritima [TaxId:2336]
    Gene: engB, TM_1466
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pr1a_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pr1A (A:)
    miirdvelvkvartpgdyppplkgevafvgrsnvgkssllnalfnrkiafvsktpgktrs
    infylvnskyyfvdlpgygyakvskkermlwkrlvedyfknrwslqmvfllvdgrippqd
    sdlmmvewmkslnipftivltkmdkvkmserakkleehrkvfskygeytiiptssvtgeg
    iselldlistllken
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pr1A (A:)
    iirdvelvkvartpgdyppplkgevafvgrsnvgkssllnalfnrsinfylvnskyyfvd
    lpgykermlwkrlvedyfknrwslqmvfllvdgrippqdsdlmmvewmkslnipftivlt
    kmdkvkmserakkleehrkvfskygeytiiptssvtgegiselldlistllk