PDB entry 3pqz

View 3pqz on RCSB PDB site
Description: Grb7 SH2 with peptide
Class: protein binding
Keywords: SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, PROTEIN BINDING
Deposited on 2010-11-29, released 2011-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.24
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB7
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB7
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Growth factor receptor-bound protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB7
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Growth factor receptor-bound protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pqzd_
  • Chain 'L':
    Compound: cyclic peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3PQZ (0-10)
  • Chain 'M':
    Compound: cyclic peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3PQZ (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >3pqzD (D:)
asgtslsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslchlq
kvkhylilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval

    Sequence, based on observed residues (ATOM records): (download) 
    >3pqzD (D:)
qlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslchlqkvkhylilpseer
lyfsmddgqtrftdllqlvefhqlnrgilpcllrhcc

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.